KEGG   Escherichia coli E24377A (ETEC): EcE24377A_2334Help
Entry
EcE24377A_2334    CDS       T00590                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcE24377A_2334 (galF)
   00052 Galactose metabolism
    EcE24377A_2334 (galF)
   00500 Starch and sucrose metabolism
    EcE24377A_2334 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EcE24377A_2334 (galF)
Enzymes [BR:ecw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcE24377A_2334 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2296357..2297250)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLELRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtatatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctcttcttgaactgcgc
gtgaagcgtcaactactggcggaagttcagtccatctgcccgccgggcgtgaccattatg
aacgtccgtcagggcgaacctttaggtttaggtcactccattttgtgtgcacgacccgcc
attggtgacaacccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagtgcc
gatccgctgcgttacaaccttgctgccatgattgcgcgtttcaatgaaacgggccgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgttattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgtgggccgttatgtgctttctgctgat
atttggccggaactagaacgcactcagcctggtgcatgggggcgtattcagctgactgat
gccatcgctgaactggcgaaaaaacagtccgttgatgccatgctgatgactggagacagc
tacgactgcggtaaaaaaatgggttatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system