KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2334Help
Entry
EcE24377A_2334    CDS       T00590                                 

Gene name
galF
Definition
(GenBank) regulatory protein GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00040  Pentose and glucuronate interconversions
ecw00052  Galactose metabolism
ecw00500  Starch and sucrose metabolism
ecw00520  Amino sugar and nucleotide sugar metabolism
ecw01100  Metabolic pathways
ecw01130  Biosynthesis of antibiotics
Module
ecw_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcE24377A_2334 (galF)
   00052 Galactose metabolism
    EcE24377A_2334 (galF)
   00500 Starch and sucrose metabolism
    EcE24377A_2334 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EcE24377A_2334 (galF)
Enzymes [BR:ecw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcE24377A_2334 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ABV20596
UniProt: A7ZNL5
Position
complement(2296357..2297250)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLELRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtatatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctcttcttgaactgcgc
gtgaagcgtcaactactggcggaagttcagtccatctgcccgccgggcgtgaccattatg
aacgtccgtcagggcgaacctttaggtttaggtcactccattttgtgtgcacgacccgcc
attggtgacaacccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagtgcc
gatccgctgcgttacaaccttgctgccatgattgcgcgtttcaatgaaacgggccgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgttattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgtgggccgttatgtgctttctgctgat
atttggccggaactagaacgcactcagcctggtgcatgggggcgtattcagctgactgat
gccatcgctgaactggcgaaaaaacagtccgttgatgccatgctgatgactggagacagc
tacgactgcggtaaaaaaatgggttatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system