KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2649Help
Entry
EcE24377A_2649    CDS       T00590                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EcE24377A_2649
   00500 Starch and sucrose metabolism
    EcE24377A_2649
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EcE24377A_2649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2639787..2641229
Genome map
AA seq 480 aa AA seqDB search
MIKMTQTRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHH
PMSEHWGPMHWGHATSDDMIHWQHEPIALAPGDDNDKDGCFSGSAVDDNGVLSLIYTGHV
WLDGAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGA
KDPGNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNA
EGYSYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDM
WESPMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSVSPRTISNKYVLQE
NAQAVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLP
QRDTLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVLQHGALWLLG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatgacgcaaactcgattgcatgcggcgcaaaacgcactagcaaaacttcat
gagcaccggggtaacactttctatccccattttcacctcgcgcctcctgccggatggatg
aacgatccaaacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcac
ccgatgagcgaacactggggaccaatgcactggggacatgccaccagcgacgatatgatc
cactggcagcatgagcctattgcgctagcgccaggagacgataatgacaaagacgggtgt
ttttcaggtagtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtc
tggctcgatggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagt
cgggatggtattcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatg
cacttccgcgatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcg
aaagatccaggcaacacggggcagatcctgctttatcgcggcagttcattgcgtgaatgg
accttcgatcgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccg
gactttttcagccttggcgatcagcattatctgatgttttccccgcagggaatgaatgcc
gagggatacagttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgcca
ggacgactttttgcacaatccgggcattttactgaacttgataacgggcatgacttttat
gcaccacaaagctttttagcgaaggatggtcggcgtattgttatcggctggatggatatg
tgggaatcgccaatgccctcaaaacgtgaaggatgggcaggctgcatgacgctggcgcgc
gagctatcagaaagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgtta
cgccagcagcatcaatctgtctctccccgcacaatcagcaataaatatgttttgcaggaa
aacgcgcaagcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacat
tacggattacagctcggcactggaatgcggctgtatattgataaccaatctgagcgactt
gttttgtggcggtattacccacacgagaatttagacggctaccgtagtattcccctcccg
cagcgtgacacgctcgccctaaggatatttatcgatacatcatccgtggaagtatttatt
aacgacggggaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactg
tcgctttatgcctcccacggagtggctgtgctgcaacatggagcactctggctactgggt
taa

DBGET integrated database retrieval system