KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3185Help
Entry
EcE24377A_3185    CDS       T00590                                 

Gene name
epaO2
Definition
type III secretion apparatus protein EpaO2
Orthology
K03225  
type III secretion protein SctQ
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
Bacterial secretion system
Class
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:ecw03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3199703..3200275)
Genome map
AA seq 190 aa AA seqDB search
MNLWLDKVTVCQYGNAPALDKKSLYWSIHFVIGFSKTCYRSLVDIEVGDVLLISNNLAYA
VIYNTKICDLIYPEELKMADHFEYEEDFETDDFDIKKNESEIYDENDDQMINSFEDLPVK
IEFVLGKKIMNLYEIDELCAKRIISLLPESEKNIKIRVNGALTGYGELVEVDDKLGVEIH
SWLSGNNNVK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctttggttagataaagtcacagtctgccaatacggaaacgctccagcgttagac
aaaaaatcattatattggtccattcattttgtaattggatttagtaaaacatgttacaga
agtcttgttgatattgaagttggtgatgttttattaatctcaaataatttggcttatgcg
gttatttataatacaaaaatttgtgatttaatttatccagaggagttaaaaatggctgat
cattttgagtacgaggaagattttgaaacagatgattttgatatcaaaaaaaacgagagt
gagatttatgatgaaaatgacgatcagatgattaatagttttgaagacttgcctgtaaaa
attgagtttgttcttggtaagaaaataatgaatctatatgaaatagacgaactctgtgca
aaaagaataatatctctgcttcctgaatctgagaaaaatataaaaatacgtgtaaatggc
gcgctaactggctatggcgaacttgttgaagtggatgataaattgggcgtagaaattcat
tcttggttatcagggaataataatgtcaaatag

DBGET integrated database retrieval system