KEGG   Escherichia coli E24377A (ETEC): EcE24377A_3185Help
Entry
EcE24377A_3185    CDS       T00590                                 

Gene name
epaO2
Definition
type III secretion apparatus protein EpaO2
Orthology
K03225  
type III secretion protein Q
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    EcE24377A_3185 (epaO2)
Secretion system [BR:ecw02044]
 Type III secretion system
  Type III secretion core apparatus [MD:M00332]
   EcE24377A_3185 (epaO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3199703..3200275)
Genome map
AA seq 190 aa AA seqDB search
MNLWLDKVTVCQYGNAPALDKKSLYWSIHFVIGFSKTCYRSLVDIEVGDVLLISNNLAYA
VIYNTKICDLIYPEELKMADHFEYEEDFETDDFDIKKNESEIYDENDDQMINSFEDLPVK
IEFVLGKKIMNLYEIDELCAKRIISLLPESEKNIKIRVNGALTGYGELVEVDDKLGVEIH
SWLSGNNNVK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctttggttagataaagtcacagtctgccaatacggaaacgctccagcgttagac
aaaaaatcattatattggtccattcattttgtaattggatttagtaaaacatgttacaga
agtcttgttgatattgaagttggtgatgttttattaatctcaaataatttggcttatgcg
gttatttataatacaaaaatttgtgatttaatttatccagaggagttaaaaatggctgat
cattttgagtacgaggaagattttgaaacagatgattttgatatcaaaaaaaacgagagt
gagatttatgatgaaaatgacgatcagatgattaatagttttgaagacttgcctgtaaaa
attgagtttgttcttggtaagaaaataatgaatctatatgaaatagacgaactctgtgca
aaaagaataatatctctgcttcctgaatctgagaaaaatataaaaatacgtgtaaatggc
gcgctaactggctatggcgaacttgttgaagtggatgataaattgggcgtagaaattcat
tcttggttatcagggaataataatgtcaaatag

DBGET integrated database retrieval system