KEGG   Escherichia coli E24377A (ETEC): EcE24377A_3185Help
Entry
EcE24377A_3185    CDS       T00590                                 

Gene name
epaO2
Definition
type III secretion apparatus protein EpaO2
Orthology
K03225  
type III secretion protein SctQ
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    EcE24377A_3185 (epaO2)
Secretion system [BR:ecw02044]
 Type III secretion system
  Type III protein secretion pathway protein [MD:M00332]
   EcE24377A_3185 (epaO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3199703..3200275)
Genome map
AA seq 190 aa AA seqDB search
MNLWLDKVTVCQYGNAPALDKKSLYWSIHFVIGFSKTCYRSLVDIEVGDVLLISNNLAYA
VIYNTKICDLIYPEELKMADHFEYEEDFETDDFDIKKNESEIYDENDDQMINSFEDLPVK
IEFVLGKKIMNLYEIDELCAKRIISLLPESEKNIKIRVNGALTGYGELVEVDDKLGVEIH
SWLSGNNNVK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctttggttagataaagtcacagtctgccaatacggaaacgctccagcgttagac
aaaaaatcattatattggtccattcattttgtaattggatttagtaaaacatgttacaga
agtcttgttgatattgaagttggtgatgttttattaatctcaaataatttggcttatgcg
gttatttataatacaaaaatttgtgatttaatttatccagaggagttaaaaatggctgat
cattttgagtacgaggaagattttgaaacagatgattttgatatcaaaaaaaacgagagt
gagatttatgatgaaaatgacgatcagatgattaatagttttgaagacttgcctgtaaaa
attgagtttgttcttggtaagaaaataatgaatctatatgaaatagacgaactctgtgca
aaaagaataatatctctgcttcctgaatctgagaaaaatataaaaatacgtgtaaatggc
gcgctaactggctatggcgaacttgttgaagtggatgataaattgggcgtagaaattcat
tcttggttatcagggaataataatgtcaaatag

DBGET integrated database retrieval system