KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3228Help
Entry
EcE24377A_3228    CDS       T00590                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase BglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00010  Glycolysis / Gluconeogenesis
ecw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcE24377A_3228 (bglA)
   00500 Starch and sucrose metabolism
    EcE24377A_3228 (bglA)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EcE24377A_3228 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ABV17576
UniProt: A7ZR10
Structure
PDB: 

Jmol
Position
3247004..3248443
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYCCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggcaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaa
ggtgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcggaagtggtgtttgaacgctataagcataaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtt
tataccgagcatgagaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccctactgctgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgat
ctcgatgtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctat
gccctttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcagtgacttacgatggtgtggatctgatg
ggttacacaccgtggggctgcatcgactgcgtgtcattcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system