KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3253Help
Entry
EcE24377A_3253    CDS       T00590                                 

Gene name
fbaA
Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:ecw01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecw01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecw00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ecw00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecw00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:ecw00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3273853..3274932)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatttttgatttcgtaaaacctggcgtaatcactggtgatgacgtacagaaa
gttttccaggtagcaaaagaaaacaacttcgcactgccagcagtaaactgcgtcggtact
gactccatcaacgccgtactggaaactgctgctaaagttaaagcgccggttatcgttcag
ttctccaacggtggtgcttcctttatcgctggtaaaggcgtgaaatctgacgttccgcag
ggtgctgctatcctgggcgcgatctctggtgcgcatcacgttcaccagatggctgaacat
tatggtgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gacggtctgctggacgcgggtgaaaaacacttcgcagctaccggtaagccgctgttctct
tctcacatgatcgacctgtctgaagaatctctgcaagagaacatcgaaatctgctctaaa
tacctggagcgtatgtccaaaatcggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgcactgtacacccagccg
gaagacgttgattacgcatacaccgagctgagcaaaatcagcccgcgtttcaccatcgct
gcgtccttcggtaacgtacacggtgtttacaagccgggtaacgtggttctgactccgacc
atcctgcgtgattctcaggaatatgtttctaagaaacacaacctgccgcacaacagcctg
aacttcgtattccacggtggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtaaaaatgaacatcgataccgatacccaatgggcaacctgggaaggcgtt
ctgaactactacaaagcgaacgaagcttatctgcagggtcagctgggtaacccgaaaggc
gaagatcagccgaacaagaaatactacgatccgcgcgtatggctgcgtgccggtcagact
tcgatgatcgctcgtctggaaaaagcattccaggaactgaacgcgatcgacgttctgtaa

DBGET integrated database retrieval system