KEGG   Escherichia coli E24377A (ETEC): EcE24377A_3380Help
Entry
EcE24377A_3380    CDS       T00590                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EcE24377A_3380 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    EcE24377A_3380 (rafA)
   00600 Sphingolipid metabolism
    EcE24377A_3380 (rafA)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     EcE24377A_3380 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3400059..3402185
Genome map
AA seq 708 aa AA seqDB search
MVSKYCRLSSPRSDLIIKTRPHAEIIWWGSALKHFSPDDCASLERPVANGRLDIDTPLTL
MAENALGLFSSPGLEGHRNGLDASPVFYTVDVEHTENTLRLTSEDSVAGLRLVSELVMTP
SGILKVRHALTNLREGDWQINRFAITLPLAERAEEVMAFHGRWTREFQPHRVRLTHDAFV
LENRRGRTSHEHFPALIVGTPGFSEQQGEVWAVHLGWSGNHRMRCEAKTDGRRYVQAEAL
WMPGEKALRKNETLYTPWLYACHSADGLNGMSQQYHRFLRDEIIRFPEQKPRPVHLNTWE
GIYFNHNPDYIMQMAERAAALGVERFIIDDGWFKGRNDDRAALGDWYTDEQKYPNGLMPV
IKHVKSLGMEFGIWVEPEMINPDSDLFRLHPDWVLSMPGYSQPTGRYQYVLNLNIPEAFA
YIYERFLWLLGEHPVDYVKWDMNRELVQAGHEGRAAADAQTRQFYRLLDLLRERFPHVEF
ESCASGGGRIDFEVLKRTHRFWASDNNDALERCTIQRGMSYFFPPEVMGAHIGHRRCHAT
FRQHSIAFRGLTALFGHMGLELDPVAADAKESDGYRRYALLYKEWRQLIHTGVLWRVDMP
DPSIQVQGVVSPDQSQALFMISQLAMPDYTLPGILRFPGLAAEVRYRLRVIDHPDLQVVG
EGGHTMRKLPVWMNQSLEASGEWLAQGGIQLPVLDPESAILIALERAV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaaagtactgcagactgagcagtcctcgctctgatttaattattaaaacccgt
ccacatgcagaaattatctggtggggctctgcactgaaacatttctcaccggatgactgt
gccagcctggaaagaccggttgcgaatggtcgtctggatattgatacgccactaacattg
atggctgaaaatgccctgggactttttagctctccgggactggaaggacacaggaatggg
ctggatgcatctcctgttttttatacagttgacgtggaacataccgaaaacactctgaga
cttaccagtgaagattcggtagccggcctgcgtctggtcagcgagctggtgatgacgcca
tcaggaattctgaaagttcgtcatgcactgaccaacctcagagagggggactggcagata
aatcgtttcgccatcactttacctttagcggaacgtgcggaagaagtcatggcttttcac
ggacgctggactcgtgaatttcagccgcacagggtacgtctcactcatgatgcttttgtt
ctggaaaatcgcagagggcggacatctcatgagcattttccggcgctgattgtcggcacg
ccaggcttctcggaacaacagggagaggtgtgggctgtgcatctggggtggagtggaaat
caccgcatgagatgtgaggcaaaaactgacggcaggcgttacgttcaggctgaggctctg
tggatgccgggtgagaaggctctcaggaagaatgaaaccctgtacaccccgtggctatat
gcctgccactctgcggatggcctgaatggaatgagtcagcaataccatcgttttttgcgt
gatgaaattatccgtttccctgagcaaaaaccccgccctgtacatctcaatacctgggaa
ggtatttatttcaatcacaatcctgattacatcatgcagatggctgagcgtgcagcagca
ctgggcgttgaacgtttcattattgatgatggctggtttaaaggacgtaacgatgaccgc
gcggctctgggcgactggtataccgatgaacagaaatacccgaacgggctgatgccggtt
attaaacatgtgaaatctctcggtatggaatttggcatatgggttgagccggaaatgatt
aacccggattctgacctgtttcgtcttcatcctgactgggtattgtcaatgcctggatat
tcccagccaaccggaagatatcagtatgttcttaacctgaatattcctgaggcctttgct
tacatttatgaacgtttcttatggttactgggagaacatccggttgattatgtgaaatgg
gacatgaatcgtgagcttgtacaggcagggcatgaaggccgtgcggcagcagatgcacag
acccgtcagttctatcgattgcttgatctcctccgtgaacgttttccacatgttgagttt
gagtcctgtgcttccggtggggggcgtattgacttcgaagtcctgaaacgcacacaccgg
ttctgggcatctgacaataatgatgccctggagcgctgcaccatacaacgtggcatgagt
tactttttccctcctgaggtgatgggggcgcatattggccatcgccgctgccatgcaact
ttccggcagcacagcatcgcttttcgtgggctgacggcattgttcggccatatggggctg
gagctggatccggtggccgcagatgcgaaggaatctgacggttatcgccggtatgccttg
ctctataaagaatggcgacaactgattcatacaggagttctctggcgtgtggatatgcca
gatccttcgatacaggttcagggagtcgtcagccctgatcagtctcaggcactttttatg
atcagccagcttgcaatgccggattacaccttaccaggcatacttcgttttcccggtctg
gcggcggaagtgcgttaccggcttcgggttattgatcacccggacctccaggtggttggt
gaaggcggtcataccatgcgcaaattacctgtctggatgaatcagagccttgaggccagt
ggtgaatggctggcacagggagggattcagctccccgtactggatccggagagtgcgatt
ttgatagcacttgaaagagctgtgtga

DBGET integrated database retrieval system