KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3380Help
Entry
EcE24377A_3380    CDS       T00590                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecw00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ecw00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ecw00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3400059..3402185
Genome map
AA seq 708 aa AA seqDB search
MVSKYCRLSSPRSDLIIKTRPHAEIIWWGSALKHFSPDDCASLERPVANGRLDIDTPLTL
MAENALGLFSSPGLEGHRNGLDASPVFYTVDVEHTENTLRLTSEDSVAGLRLVSELVMTP
SGILKVRHALTNLREGDWQINRFAITLPLAERAEEVMAFHGRWTREFQPHRVRLTHDAFV
LENRRGRTSHEHFPALIVGTPGFSEQQGEVWAVHLGWSGNHRMRCEAKTDGRRYVQAEAL
WMPGEKALRKNETLYTPWLYACHSADGLNGMSQQYHRFLRDEIIRFPEQKPRPVHLNTWE
GIYFNHNPDYIMQMAERAAALGVERFIIDDGWFKGRNDDRAALGDWYTDEQKYPNGLMPV
IKHVKSLGMEFGIWVEPEMINPDSDLFRLHPDWVLSMPGYSQPTGRYQYVLNLNIPEAFA
YIYERFLWLLGEHPVDYVKWDMNRELVQAGHEGRAAADAQTRQFYRLLDLLRERFPHVEF
ESCASGGGRIDFEVLKRTHRFWASDNNDALERCTIQRGMSYFFPPEVMGAHIGHRRCHAT
FRQHSIAFRGLTALFGHMGLELDPVAADAKESDGYRRYALLYKEWRQLIHTGVLWRVDMP
DPSIQVQGVVSPDQSQALFMISQLAMPDYTLPGILRFPGLAAEVRYRLRVIDHPDLQVVG
EGGHTMRKLPVWMNQSLEASGEWLAQGGIQLPVLDPESAILIALERAV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaaagtactgcagactgagcagtcctcgctctgatttaattattaaaacccgt
ccacatgcagaaattatctggtggggctctgcactgaaacatttctcaccggatgactgt
gccagcctggaaagaccggttgcgaatggtcgtctggatattgatacgccactaacattg
atggctgaaaatgccctgggactttttagctctccgggactggaaggacacaggaatggg
ctggatgcatctcctgttttttatacagttgacgtggaacataccgaaaacactctgaga
cttaccagtgaagattcggtagccggcctgcgtctggtcagcgagctggtgatgacgcca
tcaggaattctgaaagttcgtcatgcactgaccaacctcagagagggggactggcagata
aatcgtttcgccatcactttacctttagcggaacgtgcggaagaagtcatggcttttcac
ggacgctggactcgtgaatttcagccgcacagggtacgtctcactcatgatgcttttgtt
ctggaaaatcgcagagggcggacatctcatgagcattttccggcgctgattgtcggcacg
ccaggcttctcggaacaacagggagaggtgtgggctgtgcatctggggtggagtggaaat
caccgcatgagatgtgaggcaaaaactgacggcaggcgttacgttcaggctgaggctctg
tggatgccgggtgagaaggctctcaggaagaatgaaaccctgtacaccccgtggctatat
gcctgccactctgcggatggcctgaatggaatgagtcagcaataccatcgttttttgcgt
gatgaaattatccgtttccctgagcaaaaaccccgccctgtacatctcaatacctgggaa
ggtatttatttcaatcacaatcctgattacatcatgcagatggctgagcgtgcagcagca
ctgggcgttgaacgtttcattattgatgatggctggtttaaaggacgtaacgatgaccgc
gcggctctgggcgactggtataccgatgaacagaaatacccgaacgggctgatgccggtt
attaaacatgtgaaatctctcggtatggaatttggcatatgggttgagccggaaatgatt
aacccggattctgacctgtttcgtcttcatcctgactgggtattgtcaatgcctggatat
tcccagccaaccggaagatatcagtatgttcttaacctgaatattcctgaggcctttgct
tacatttatgaacgtttcttatggttactgggagaacatccggttgattatgtgaaatgg
gacatgaatcgtgagcttgtacaggcagggcatgaaggccgtgcggcagcagatgcacag
acccgtcagttctatcgattgcttgatctcctccgtgaacgttttccacatgttgagttt
gagtcctgtgcttccggtggggggcgtattgacttcgaagtcctgaaacgcacacaccgg
ttctgggcatctgacaataatgatgccctggagcgctgcaccatacaacgtggcatgagt
tactttttccctcctgaggtgatgggggcgcatattggccatcgccgctgccatgcaact
ttccggcagcacagcatcgcttttcgtgggctgacggcattgttcggccatatggggctg
gagctggatccggtggccgcagatgcgaaggaatctgacggttatcgccggtatgccttg
ctctataaagaatggcgacaactgattcatacaggagttctctggcgtgtggatatgcca
gatccttcgatacaggttcagggagtcgtcagccctgatcagtctcaggcactttttatg
atcagccagcttgcaatgccggattacaccttaccaggcatacttcgttttcccggtctg
gcggcggaagtgcgttaccggcttcgggttattgatcacccggacctccaggtggttggt
gaaggcggtcataccatgcgcaaattacctgtctggatgaatcagagccttgaggccagt
ggtgaatggctggcacagggagggattcagctccccgtactggatccggagagtgcgatt
ttgatagcacttgaaagagctgtgtga

DBGET integrated database retrieval system