KEGG   Escherichia coli E24377A (ETEC): EcE24377A_4019Help
Entry
EcE24377A_4019    CDS       T00590                                 

Gene name
bcsZ
Definition
(GenBank) cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ecw  Escherichia coli E24377A (ETEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4001018..4002115)
Genome map
AA seq 365 aa AA seqDB search
MRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFF
ALAANDRVAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVWMAW
SLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYL
PPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYD
AIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAA
MLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQE
CANSH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtagtggaatcgtgacgatgctgctgttggctgcctttagtgttcaggcagcctgt
acctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaagggcgcgtcatc
gaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggtatgttcttt
gccctggcggctaacgaccgtgtagctttcgataatattctcgactggacgcagaacaat
ctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaagaaagagaac
agtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctggatggcctgg
tcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatcggcagcgcg
ttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggttccatgttg
ttaccgggcaaagtgggttttgctgaggataacagctggcgttttaaccccagctacctg
ccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacgctgcgcgaa
accaatcaacgtttattgctggaaaccgccccgaaaggtttttcgccagactgggtgcgc
tatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagcagctacgac
gctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaaaaagcgcgg
atgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttatccgccggaa
aaagtggatgtggctacggggaaagcgcagggtaaaggaccggtcggtttttctgccgcc
atgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgcgtggccgat
aactttcccggcagcgatgcctattacaactatgtgctgaccctgtttggacaaggctgg
gatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactggggccaggaa
tgcgcaaattcacactaa

DBGET integrated database retrieval system