KEGG   Escherichia coli E24377A (ETEC): EcE24377A_4019Help
Entry
EcE24377A_4019    CDS       T00590                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcE24377A_4019 (bcsZ)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EcE24377A_4019 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4001018..4002115)
Genome map
AA seq 365 aa AA seqDB search
MRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFF
ALAANDRVAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVWMAW
SLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYL
PPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYD
AIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAA
MLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQE
CANSH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtagtggaatcgtgacgatgctgctgttggctgcctttagtgttcaggcagcctgt
acctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaagggcgcgtcatc
gaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggtatgttcttt
gccctggcggctaacgaccgtgtagctttcgataatattctcgactggacgcagaacaat
ctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaagaaagagaac
agtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctggatggcctgg
tcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatcggcagcgcg
ttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggttccatgttg
ttaccgggcaaagtgggttttgctgaggataacagctggcgttttaaccccagctacctg
ccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacgctgcgcgaa
accaatcaacgtttattgctggaaaccgccccgaaaggtttttcgccagactgggtgcgc
tatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagcagctacgac
gctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaaaaagcgcgg
atgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttatccgccggaa
aaagtggatgtggctacggggaaagcgcagggtaaaggaccggtcggtttttctgccgcc
atgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgcgtggccgat
aactttcccggcagcgatgcctattacaactatgtgctgaccctgtttggacaaggctgg
gatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactggggccaggaa
tgcgcaaattcacactaa

DBGET integrated database retrieval system