KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_4342Help
Entry
EcE24377A_4342    CDS       T00590                                 

Gene name
pldA
Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00564  Glycerophospholipid metabolism
ecw00565  Ether lipid metabolism
ecw00590  Arachidonic acid metabolism
ecw00592  alpha-Linolenic acid metabolism
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EcE24377A_4342 (pldA)
   00565 Ether lipid metabolism
    EcE24377A_4342 (pldA)
   00590 Arachidonic acid metabolism
    EcE24377A_4342 (pldA)
   00591 Linoleic acid metabolism
    EcE24377A_4342 (pldA)
   00592 alpha-Linolenic acid metabolism
    EcE24377A_4342 (pldA)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     EcE24377A_4342 (pldA)
    3.1.1.32  phospholipase A1
     EcE24377A_4342 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ABV21085
UniProt: A7ZU28
Structure
PDB: 

Jmol
Position
4330557..4331426
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atttacacccaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttcagacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggagttatgctaaacgatttgttttga

DBGET integrated database retrieval system