KEGG   Escherichia coli E24377A (ETEC): EcE24377A_4506Help
Entry
EcE24377A_4506    CDS       T00590                                 

Gene name
trmA
Definition
tRNA (uracil-5-)-methyltransferase (EC:2.1.1.35)
Orthology
K00557  
tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
Organism
ecw  Escherichia coli E24377A (ETEC)
Brite
Enzymes [BR:ecw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.35  tRNA (uracil54-C5)-methyltransferase
     EcE24377A_4506 (trmA)
Transfer RNA biogenesis [BR:ecw03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    EcE24377A_4506 (trmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4499282..4500382)
Genome map
AA seq 366 aa AA seqDB search
MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYRMRAEFRIWHDGDDLY
HIIFDQQTKSRIRVDSFPAASELINQLMTAMIAGVRNNPVLRHKLFQIDYLTTLSNQAVV
SLLYHKKLDDEWRQEAEALRDALRAQNLNVHLIGRATKTKIELDQDYIDERLPVAGKEMI
YRQVENSFTQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFDRVLATEI
AKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKSYQCETIFVDP
PRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
VLLTAK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaacaccttccaacagaacagtatgaagcgcagttagccgaaaaagtggta
cgtttgcaaagtatgatggcaccgttttctgacctggttccggaagtgtttcgctcgccg
gtcagtcattaccggatgcgtgcggagttccgcatctggcacgatggcgatgacctgtat
cacatcattttcgatcaacaaaccaaaagccgcatccgcgtggatagcttccccgctgcc
agtgaactcatcaaccagttgatgacggcgatgattgcgggtgtgcgtaataatcccgtt
ctgcgccacaagttgttccagattgattacctcaccacgctgagtaatcaggcggtggtt
tccctgttgtaccataaaaagctggatgatgagtggcgtcaggaagctgaagccctgcgc
gatgcactgcgcgcgcagaatctgaatgtgcatctgattggtcgggcaacgaaaaccaaa
atcgagctggatcaagattacatcgatgaacgtctgccggtcgcagggaaagagatgatc
taccgtcaggtagaaaacagttttacccagccgaacgcggcgatgaatattcagatgctg
gaatgggcgctggacgtaaccaaaggctcaaaaggcgatttactggagctgtactgcggc
aacggtaacttttcattagcactggcgcgcaattttgatcgggtattagccaccgaaatc
gctaagccgtcggttgctgctgcgcaatacaacatcgcagctaaccatattgataacgta
caaattattcgtatggcggcagaagaatttactcaggcgatgaatggtgtacgcgagttt
aatcgcctgcaagggatagacttgaagagttatcagtgcgaaaccatttttgtcgaccca
ccgcgcagcggtctggacagtgaaaccgagaaaatggtgcaggcgtatccacgtattctg
tatatctcctgcaatccggaaacgttatgcaagaatctggaaacattaagccagacgcac
aaggtcgaacgtctggctctgtttgatcagttcccctacacgcaccatatggagtgcggc
gtattactgaccgcgaagtaa

DBGET integrated database retrieval system