KEGG   Escherichia coli E24377A (ETEC): EcE24377A_4557Help
Entry
EcE24377A_4557    CDS       T00590                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcE24377A_4557 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EcE24377A_4557 (aceA)
Enzymes [BR:ecw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EcE24377A_4557 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4553708..4555012
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccatacagcgcggaagatgtggtgaaattacgcggttcagtcaat
cctgaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgtctgctgcatggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggcggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagctgtg
gtggagcggatcaacaacaccttccgtcgtgccgatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgttgccgatgcggaagcc
ggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcgtcagtgaagaaatgcggtcacatgggcggc
aaagttttggtgccaactcaagaagctattcagaaactggtcgcggcgcgtctggcagct
gacgtgacgggcgttccaaccctactggttgctcgtaccgatgccgatgcagcggatctg
atcacctccgattgcgacccgtatgacagcgaatttattaccggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggcattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtctggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagctatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactacgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgactattattcagggcggcacgtct
tcagtcaccgcgctgaccggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system