KEGG   Escherichia coli E24377A (ETEC): EcE24377A_F0020Help
Entry
EcE24377A_F0020   CDS       T00590                                 

Gene name
eltA
Definition
heat-labile enterotoxin A
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
ecw  Escherichia coli E24377A (ETEC)
Brite
Enzymes [BR:ecw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     EcE24377A_F0020 (eltA)
Bacterial toxins [BR:ecw02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    EcE24377A_F0020 (eltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pETEC_80:16616..17425
Genome map
AA seq 269 aa AA seqDB search
MSSCMIYKFSSMKNITFIFFILLASPLYANGDKLYRADSRPPDEIKRSGGLMPRGHNEYF
DRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATA
PNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYR
NLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYL
RKYQSKVKRQIFSDYQSEVDIYNRIRDEL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttcttgtatgatatataagttttcctcgatgaaaaatataactttcatttttttt
attttattagcatcgccattatatgcaaatggcgacaaattataccgtgctgactctaga
cccccagatgaaataaaacgttccggaggtcttatgcccagagggcataatgagtacttc
gatagaggaactcaaatgaatattaatctttatgatcacgcgagaggaacacaaaccggc
tttgtcagatatgatgacggatatgtttccacttctcttagtttgagaagtgctcactta
gcaggacagtctatattatcaggatattccacttactatatatatgttatagcgacagca
ccaaatatgtttaatgttaatgatgtattaggcgtatacagccctcacccatatgaacag
gaggtttctgcgttaggtggaataccatattctcagatatatggatggtatcgtgttaat
tttggtgtgattgatgaacgattacatcgtaacagggaatatagagaccggtattacaga
aatctgaatatagctccggcagaggatggttacagattagcaggtttcccaccggatcac
caagcttggagagaagaaccctggattcatcatgcaccacaaggttgtggaaattcatca
agaacaattacaggtgatacttgtaatgaggagacccagaatctgagcacaatatatctc
aggaaatatcaatcaaaagttaagaggcagatattttcagactatcagtcagaggttgac
atatataacagaattcgggatgaattatga

DBGET integrated database retrieval system