KEGG   Escherichia coli O9 HS (commensal): EcHS_A0175Help
Entry
EcHS_A0175        CDS       T00591                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EcHS_A0175 (dxr)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     EcHS_A0175 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
191679..192875
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcaccattctgggctcgaccggctcgattggttgcagcacgctggacgtg
gtgcgccataatcccgaacacttccgcgtagttgcgctggtggcaggcaaaaatgtcact
cgcatggtagaacagtgcctggaattctctccccgctatgccgtaatggacgatgaagcg
agtgcgaaacttcttaaaacgatgctacagcaacagggtagccgcaccgaagtcttaagt
gggcaacaagccgcttgcgatatggcagcgcttgaggatgttgatcaggtgatggcagcc
attgttggcgctgctgggctgttacctacgcttgctgcgatccgcgcgggtaaaaccatt
ttgctggccaataaagaatcactggttacctgcggacgtctgtttatggacgccgtaaag
cagagcaaagcgcaattgttaccggtcgatagcgaacataacgccatttttcagagttta
ccgcaacctatccagcataatctgggatacgctgaccttgagcaaaatggcgtggtgtcc
attttacttaccgggtctggtggccctttccgtgagacgccattgcgcgatttggcaaca
atgacgccggatcaagcctgccgtcatccgaactggtcgatggggcgtaaaatttctgtc
gattcggctaccatgatgaacaaaggtctggaatacattgaagcgcgttggctgtttaac
gccagcgccagccagatggaagtgctgattcacccgcagtcagtgattcactcaatggtg
cgctatcaggacggcagtgttctggcgcagctgggggaaccggatatgcgtacgccaatt
gcccacaccatggcatggccgaatcgcgtgaactctggcgtgaagccgctcgatttttgc
aaactaagtgcgttgacatttgccgcaccggattatgatcgttatccatgcctgaaactg
gcgatggaggcgttcgaacaaggtcaggcagcgacgacagcattgaatgccgcaaacgaa
atcaccgttgctgcttttcttgcgcaacaaatccgctttacggatatcgctgcgttgaat
ttatccgtactggaaaaaatggatatgcgcgaaccacaatgtgtggacgatgtgttatct
gttgatgcgaacgcgcgtgaagtcgccagaaaagaggtgatgcgtctcgcaagctga

DBGET integrated database retrieval system