KEGG   Escherichia coli O9 HS (commensal): EcHS_A0931Help
Entry
EcHS_A0931        CDS       T00591                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EcHS_A0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934006..934518
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDAAVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattggt
aatacgtcaggcgtcattcccggcaaaaccattacggagcgacaggcagcagaagggctg
atctccaacgtgctgcgtgtggagcgggcgctggaaaggtgtgtgaagcaacagccgccg
cagaaggtgtatgacgccgcggtgtcgtttgccttcaacgtgggaacgggcaatgcctgc
agttccacgctggtgaaattactcaatcagcggcgctgggcagatgcgtgccgacagttg
ccgcgctgggtttatgtgaaaggtgtttttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgtttacagggagcaaactga

DBGET integrated database retrieval system