KEGG   Escherichia coli O9 HS (commensal): EcHS_A1230Help
Entry
EcHS_A1230        CDS       T00591                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EcHS_A1230 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    EcHS_A1230 (nagZ)
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EcHS_A1230 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227775..1228800
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALSGMEEGGKLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETP
CDPRPQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAVIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaata
ctggcgcatccgctggtgggagggctgattctctttacgcgtaactatcatgatcctgcc
cagttacgtgaactggtgcgccagatccgcgcagcttcgcgcaatcatctggtggtggcg
gttgatcaggaaggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcg
gcgcaatcattcgctgcgctgtcaggaatggaagagggtggcaaactggcgcaggaggca
ggttggttgatggccagcgaaatgatcgctatggatattgatatcagctttgcgcctgtg
ctggatgtcgggcatatcagcgcggcgattggcgagcgttcttatcatgccgatccacaa
aaagccctggcaattgccagccggtttattgatggtatgcatgaagccggaatgaaaacg
accgggaaacacttcccaggacacggtgcagtaacggcagactcacacaaagaaacaccg
tgcgatccacgtccacaagcggagattcgcgctaaagatatgtcggtcttcagttcctta
atccgcgaaaataaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgat
ccgcgtccggcgagcggttctccctactggctgaaaaccgttttgcgtcaggaactgggt
tttgacggcgtgattttctctgacgatttatcgatggaaggtgccgtgattatgggcagt
tatgccgaacgcgggcaggcatcactggatgcgggttgcgatatgatcctggtctgcaat
aatcgtaaaggggccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgtt
acacgtttgtatcataaaggttcattttcgcgacaggaactgatggactcggctcgctgg
aaagcgatcagcgcccgtctgaatcagttacatgaacgctggcaggaagagaaagcaggt
cactaa

DBGET integrated database retrieval system