KEGG   Escherichia coli O9 HS (commensal): EcHS_A1424Help
Entry
EcHS_A1424        CDS       T00591                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcHS_A1424
Enzymes [BR:ecx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EcHS_A1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1417666..1419345
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILELVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSLPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLITLR
RSHNEFHPDNNFTIDTINLSVMRIQRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISE
VDILGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagc
aatgatttaaaaccattacccacatttaatcagttttaccatcaatggctgcaaagcatt
ttttcacatgttcatttgttgccgttttatccatggtcatctgatgatggcttttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcatccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttgctggcgatggtggatgttttactctgttaccttgcg
aaaggtgctgagtatgtccgcctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgttgcgccaggtacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgcaggcgatgacgaagcacatatggtgtaccagttctcgctgccgcca
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggctaaacccgctacggggcttgttgcctgaaagcgaaatattagagctggtcgaggcg
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacacgcagtccg
tatgaaataaatgtgacctatatggatgcgttaagccgccgtgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtctccccggtgtgccagcg
atatatattcaaagtattcttggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaatatcacagtaaagagataacccgagaactgaac
gatgaagctacattaaggcatgcggtatatcatgagttgtcgcgtttaattacacttcgt
cgcagccataacgagtttcatccggataataattttaccattgatacgattaatttatcc
gtaatgcgtattcaaagaagtaacgctgatggtaattgtctgactggattgtttaatgtc
agtaaaaatattcagcatgtaaatattactaatctgcatggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system