KEGG   Escherichia coli O9 HS (commensal): EcHS_A1615Help
Entry
EcHS_A1615        CDS       T00591                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecx00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1637085..1638524)
Genome map
AA seq 479 aa AA seqDB search
MSGFKKGFLWGGAVAAHQLEGGWNEGGKGISIADVMTAVAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIRFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDINEREQIMYQAVHYELVASALAVQTGKSINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPEDN
AILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWLWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFASHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaaaaaggttttttatggggcggcgcggtagccgcgcatcagttggaa
ggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtgatgactgctgtcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacgggcttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgagatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctgttcgatgaatgccttaagcag
ggaatggaacctgtggtgacgctttcacattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccgcttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatatcaatgagcgcgaacaaataatgtaccaggcggtacattacgagttagttgcc
agtgccctggcggtacagactggaaaatcgattaatcctgaatttaatatcggctgcatg
atcgccatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatggcgacg
aaagcgatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgccaggaaaggattcaacctcgatatcacaccagaagataac
gcgattcttgccagaggttgtgtcgactttatcggttttagctactacatgtcttttacg
acacaattttcgcccgataacccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttgtgggatcatttccagttgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacagtgaacgatcactatcgcattgattac
tttgcttcccatattcgtgaaatgaaaaaagccgtagtcgaagatggtgttgacttaatt
ggctacaccccgtggggctgcattgacctggtttctgccggaacaggggaaatgaaaaaa
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaaaggata
cgtaaagcgtcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatttga

DBGET integrated database retrieval system