KEGG   Escherichia coli O9 HS (commensal): EcHS_A1644Help
Entry
EcHS_A1644        CDS       T00591                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecx  Escherichia coli O9 HS (commensal)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1668584..1669117)
Genome map
AA seq 177 aa AA seqDB search
MNVKIRYSLSAAVLALIAASAPAPDILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCAQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaaatcagatacagcctgtcggccgctgttctggcactgattgccgccagt
gctcctgcccctgacattctcgatcagtttctggatgaaaaagaggggaatcacaccact
gcataccgcgatggctccggcatatggaccatctgtcggggagcaacgatggtggacggt
aaacctgttattccgggaatgaaactgtcgaaggaaaaatgcgcccaggttaacgccatt
gagcgggataaggcgctggcatgggtggagcgcaatataaaagttccactgaccgagcca
cagaaagccggtatcgcgtcattctgtccctataacattggccctggtaagtgttttccg
tcgacgttttataagcggcttaatgccggtgatcgtaaaggcgcatgcgaggcgattcgc
tggtggataaaggacggtggacgtgattgccgcattcgttcaaataattgttacggtcag
gttattcggcgtgaccaggagagtgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system