KEGG   Escherichia coli O9 HS (commensal): EcHS_A1865Help
Entry
EcHS_A1865        CDS       T00591                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00010  Glycolysis / Gluconeogenesis
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01120  Microbial metabolism in diverse environments
ecx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcHS_A1865
Enzymes [BR:ecx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EcHS_A1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABV06176
Position
1881806..1882711
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHHEDAD
GVALTFELTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKENVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSISMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgcg
ggtgaagaagaagttctgtggttgagcaacaacacaccgttcaaaaatggcgtcgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggcggcacaacaaggtctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcatgaagatgctgat
ggcgtagcgctgacttttgaattgacgcaaagcgaagagacgaaaaaattctggccgcac
gactttacgctgttagcgcatttccgcgtgggtaaaacttgtgaaatcgatcttgaatca
catggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtgggctgggcgatcgcttcattgataaagtgaatgacgcgaaagaa
aatgtactgaccgatggtattcagaccttccctgaccgtaccgatcgcgtgtatctgaat
ccacaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtcggctggaacccgggaccggcgctttcaattagcatgggc
gatatgccggatgatggctacaaaacatttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtgaccaaagagaaacctgcacatctggcgcaatccattcgcgttgcgaaa
cgttaa

DBGET integrated database retrieval system