KEGG   Escherichia coli O9 HS (commensal): EcHS_A2439Help
Entry
EcHS_A2439        CDS       T00591                                 

Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    EcHS_A2439
   01230 Biosynthesis of amino acids
    EcHS_A2439
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcHS_A2439
   00290 Valine, leucine and isoleucine biosynthesis
    EcHS_A2439
Enzymes [BR:ecx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EcHS_A2439
    2.6.1.66  valine---pyruvate transaminase
     EcHS_A2439
Amino acid related enzymes [BR:ecx01007]
 Aminotransferase (transaminase)
  Class I
   EcHS_A2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2449132..2450349
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaacccagccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgatacgc
aacctgcctaccgctcaagggtattgcgattccaaaggtctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcaccagattacccactatggaccgcggcggtttcgctttccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggacctcgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
accggcgcggtatattccaaagagcttttaatggagattgtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactcaattgcaccgctggcacctgacctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggctacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctaggtggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcgtgggaactgatcaacgatatt
ccgggcgtttcctgcgtgaaacctcgtggtgcgctgtatatgttcccgaaaatcgacgcc
aaacgctttaacattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system