KEGG   Escherichia coli O9 HS (commensal): EcHS_A2492Help
Entry
EcHS_A2492        CDS       T00591                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00071  Fatty acid degradation
ecx00280  Valine, leucine and isoleucine degradation
ecx00281  Geraniol degradation
ecx00310  Lysine degradation
ecx00362  Benzoate degradation
ecx00380  Tryptophan metabolism
ecx00410  beta-Alanine metabolism
ecx00640  Propanoate metabolism
ecx00650  Butanoate metabolism
ecx00903  Limonene and pinene degradation
ecx00930  Caprolactam degradation
ecx01040  Biosynthesis of unsaturated fatty acids
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01120  Microbial metabolism in diverse environments
ecx01130  Biosynthesis of antibiotics
ecx01200  Carbon metabolism
ecx01212  Fatty acid metabolism
Module
ecx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcHS_A2492 (fadJ)
   00650 Butanoate metabolism
    EcHS_A2492 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EcHS_A2492 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EcHS_A2492 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcHS_A2492 (fadJ)
   00310 Lysine degradation
    EcHS_A2492 (fadJ)
   00380 Tryptophan metabolism
    EcHS_A2492 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcHS_A2492 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcHS_A2492 (fadJ)
   00281 Geraniol degradation
    EcHS_A2492 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcHS_A2492 (fadJ)
   00930 Caprolactam degradation
    EcHS_A2492 (fadJ)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EcHS_A2492 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcHS_A2492 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EcHS_A2492 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABV06764
UniProt: A8A2L0
Position
complement(2498636..2500780)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPDEKMNTLKAEFASQVRAIIKQLRENKELRGVVFISA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKKDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGAGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccggatgagaaaatgaataccctgaaggcggaatttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgcggcgtggtgtttatctccgcg
aaaccggacaattttatcgccggagcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagctctggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgtcgttccgcactccattctgctggaagccgctgttgag
ctggcaaagaaggatcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagtggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggctctgcgtagtatcttttttgccagtacggacgtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
gccggtattgcttatgtcaccgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgccgctcataccattttt
gcttcgaacacgtcatctttaccgattggtgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtagagattatt
cctcatgcgggtacatcggcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaactcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagagcacattgat
gctgcgctagtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcctgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttggtcgagatgggcgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system