KEGG   Escherichia coli O9 HS (commensal): EcHS_A2965Help
Entry
EcHS_A2965        CDS       T00591                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ecx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2968954..2970780)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHSRWYEGR
PVMIARNDSALGVFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccgctggat
gtgcaatttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcggca
ctgttaagtcatgatgccggagagggacacgtttgtttgccgctttcacgactggaaaat
aacgaggcgtcgcatccgctgttggcgacctgtgtcagtgaaatcggtgagctacaaaat
tgggaagaatgcttgctggcttctcaagcggtcagcaggggagatgaacccacgccgatg
atcctctgtggcgatcgtctttatttgaatcgcatgtggtgtaacgagcgcacagtggca
cgctttttcaacgaagtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagttgcggcggcagtg
gcgctgacgcggcggatctcggtgatttccggcggccctggcaccggtaaaacgaccacc
gtagcgaagttgctggcagcgttaattcaaatggccgacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgacagttaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagcactttg
caccgattgctgggcgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatctgcctatgatgtcg
agactgatcgacgccttgcccgatcatgcgcgagtgatctttctcggcgatcgtgatcaa
ctggcctcggttgaggctggggctgtgctgggcgatatctgcgcttatgccaacgcgggc
tttaccgccgagcgtgccaggcagctaagccgcctgacggggactcacgttccggcagga
accggcacagaagcggcatctttgcgcgacagtctctgcctgctgcaaaaaagctatcgt
ttcggcagcgattctggcattggtcagttagctgcggcgatcaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggattttactgatatcgaaaaacggcttttacagagc
ggcgaagattatattgcgatgcttgaggaagctcttgcgggttacggacgttatctggat
ctgctgcaagcgcgtgccgagccggatttaatcattcaggcgttcaatgagtaccagctt
ttgtgcgccctgcgggaagggccgtttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtcatccgcactctcgttggtacgaaggtcga
ccggtgatgattgcccgtaatgacagcgcgcttggggtgtttaatggcgatatcggtatt
gcgctggatcgcgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaactacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttgccgagccaacgcacgccggta
gtaacgcgagagctggtttataccgcggtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgcatattaagtgcggcaatcgccactcgtactgagcggcgcagtggtctg
gcggcgttgtttagttcacgggaataa

DBGET integrated database retrieval system