KEGG   Escherichia coli O9 HS (commensal): EcHS_A3675Help
Entry
EcHS_A3675        CDS       T00591                                 

Gene name
nikA
Definition
nickel ABC transporter periplasmic nickel-binding protein NikA (EC:3.6.3.24)
Orthology
K15584  
nickel transport system substrate-binding protein
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ABC transporters
Module
Nickel transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ecx02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3659937..3661511
Genome map
AA seq 524 aa AA seqDB search
MLSTLRRTLFALLACASFIVHAAAPDEITTTWPVNVGPLNPHLYTPNQMFAQSMVYEPLV
KYQADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRAVLDNRQRH
AWLELANQIVDVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA
PIGTGPWILQESKLNQYDVFVRNENYWGEKPAIKKITFNVIPDPTTRAVAFETGDIDLLY
GNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTNELAVREALNYAVNKKSL
IDNALYGTQQVADTLFAPSVPYANLGLKPRQYDPQKAKALLEKAGWTLPAGKDIREKNGQ
PLRIELSFIGTDALSKSMAEIIQADMRQIGADVSLIGEEESSIYARQRDGRFGMIFHRTW
GAPYDPHAFLSSMRVPSHADFQAQQGLADKPLIDKEIGEVLATHDETQRQALYRDILTRL
HDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPFEQIKPVKP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctctccacactccgccgcactctatttgcgctgctggcttgtgcgtcttttatcgtc
catgccgctgcaccagatgaaatcaccaccacctggccggtgaatgtcgggccactaaac
ccgcacctttacacgcctaaccagatgttcgcccagagcatggtttatgaaccattggtg
aaatatcaggcagacggttcggtgatcccgtggctggcaaaaagctggactcattcagaa
gatggtaaaacctggaccttcaccctgcgtgatgacgtgaaattctccaacggtgaaccg
ttcgatgccgaggcggcggcagaaaacttccgcgcagtgctcgataaccgtcaacgtcac
gcctggctggagctggcaaaccagattgttgatgttaaagcactcagtaaaacagagctg
caaattaccctgaaaagcgcctactatcctttcctgcaagaactggccctgccccgtcct
ttccgttttatcgctccctcgcagtttaaaaaccatgaaaccatgaacggaattaaagcg
ccgattggcaccggaccgtggattttgcaggaatcgaaactgaatcagtacgatgtcttc
gtccgtaacgaaaactactggggcgaaaagccagcgattaaaaagatcacctttaacgtc
atcccggacccgactacccgcgcggtggcgtttgaaactggcgatatcgacctgctgtac
ggaaacgaagggttattaccgctcgataccttcgcccgctttagccagaatccggcttac
cacacccaactgtcacagccgatcgaaaccgtgatgctggcgctcaataccgccaaagcc
cccaccaacgagctggcagtacgtgaagctcttaattacgcggtaaacaaaaaatcgctg
attgataacgcgttgtatggcacccagcaggtcgccgacaccctgtttgccccttctgtg
ccctacgccaacctcggcctgaaaccgcgccagtacgatccgcaaaaagcgaaagcgttg
ctggaaaaagccggttggacgctgcctgcgggcaaagacatccgcgagaaaaatggtcag
ccgctgcgcattgaactttcgttcatcggcaccgatgcgttaagcaaatcgatggcggaa
atcattcaggctgatatgcgccagattggcgcagatgtctcgctgattggcgaagaagag
agcagtatctatgctcgtcagcgcgacggtcgttttggcatgattttccaccgcacctgg
ggcgcgccatatgatccacacgccttcctcagttcaatgcgcgtaccgtcacacgctgac
ttccaggcacagcaaggattagccgacaaaccgctgattgataaagagatcggcgaagtg
ctggcgacccatgacgaaacgcaacgtcaggcgctgtatcgcgacattctgacccgtctg
catgacgaggcggtttatctgcctatcagttacatctcaatgatggtggtatcaaaaccg
gagctgggtaacatcccctacgcgccgatcgccaccgaaattccgttcgaacagattaaa
ccggtgaaaccttaa

DBGET integrated database retrieval system