KEGG   Escherichia coli O9 HS (commensal): EcHS_A3968Help
Entry
EcHS_A3968        CDS       T00591                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EcHS_A3968 (rbsK)
Enzymes [BR:ecx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EcHS_A3968 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3964473..3965402
Genome map
AA seq 309 aa AA seqDB search
MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV
PGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IDAFLDRQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgcaggcagcctcgttgttcttggcagcattaatgctgaccacattcttaat
cttcaatcttttcctactccaggcgaaaccgtaaccggtaaccactatcaggttgcattt
ggcggcaaaggcgcgaatcaggctgtggctgctgggcgtagcggtgcgaatatcgcgttt
attgcctgtacgggtgatgacagcattggtgagagcgttcgccagcagctcgccactgat
aacattgatattactccggtcagcgtgatcaaaggcgaatcaacaggtgtggcgctgatt
tttgttaatggcgaaggtgagaatgtcatcggtattcatgccggcgctaatgctgccctt
tccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcgtcagcattattaatg
cagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatcgcccatcaaaataag
actatcgttgcgcttaacccggctccggctcgcgaacttcctgacgaactgctggcgctg
gtggacattattacgccaaacgaaacggaagcagaaaagctcaccggtattcgtgttgaa
aatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaaggtatccgtactgta
ctgattactttaggaagtcgtggtgtatgggctagcgtgaatggtgaaggtcagcgcgtt
cctggattccgggtgcaggctgtcgataccattgctgccggagatacctttaacggtgcg
ttaatcacggcattgctggaagaaaaaccattgccagaggcgattcgttttgcccatgct
gccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgtaccgtggcgtgaagag
atcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system