KEGG   Escherichia coli O9 HS (commensal): EcHS_A4150Help
Entry
EcHS_A4150        CDS       T00591                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00010  Glycolysis / Gluconeogenesis
ecx00051  Fructose and mannose metabolism
ecx00562  Inositol phosphate metabolism
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01120  Microbial metabolism in diverse environments
ecx01130  Biosynthesis of antibiotics
ecx01200  Carbon metabolism
ecx01230  Biosynthesis of amino acids
Module
ecx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecx_M00002  Glycolysis, core module involving three-carbon compounds
ecx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcHS_A4150 (tpiA)
   00051 Fructose and mannose metabolism
    EcHS_A4150 (tpiA)
   00562 Inositol phosphate metabolism
    EcHS_A4150 (tpiA)
Enzymes [BR:ecx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EcHS_A4150 (tpiA)
Exosome [BR:ecx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EcHS_A4150 (tpiA)
  Exosomal proteins of bladder cancer cells
   EcHS_A4150 (tpiA)
  Exosomal proteins of melanoma cells
   EcHS_A4150 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV08328
UniProt: A8A724
Structure
PDB: 

Jmol
Position
complement(4138749..4139516)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacttctgcc
gctatgctgaaagacatcggcgctcagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagatatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system