KEGG   Escherichia coli O9 HS (commensal): EcHS_A4249Help
Entry
EcHS_A4249        CDS       T00591                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcHS_A4249 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EcHS_A4249 (aceA)
Enzymes [BR:ecx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EcHS_A4249 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
4246265..4247569
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccatacagcgcggaagatgtggtgaaattacgcggttcagtcaat
cctgaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgtctgctgcatggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggcggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagctgtg
gtggagcggatcaacaacaccttccgtcgtgccgatcagatccaatggtccgcaggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgttgccgatgcggaagcc
ggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcgtcagtgaagaaatgcggtcacatgggcggc
aaagttttggtgccaactcaggaagctattcagaaactggtcgcggcgcgtcttgcagct
gacgtgacgggcgttccaaccctgctggttgctcgtaccgatgccgatgcggcggatctg
attacctccgattgcgacccgtatgacagtgaatttattactggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggcattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtctggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagctatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactacgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgactattattcagggcggcacgtct
tcagtcaccgcgctgaccggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system