KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0172Help
Entry
ECSE_0172         CDS       T00784                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ecy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
194046..195242
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcaccattctgggctcgaccggctcgattggttgcagcacgctggacgtg
gtgcgccataatcccgaacacttccgcgtagttgcgctggtggcaggcaaaaatgtcact
cgcatggtagaacagtgcctggaattctctccccgctatgccgtaatggacgatgaagcg
agtgcgaaacttcttaaaacgatgctacagcaacagggtagccgcaccgaagtcttaagt
gggcaacaagccgcttgcgatatggcagcgcttgaggatgttgatcaggtgatggcagcc
attgttggcgctgctgggctgttacctacgcttgctgcgatccgcgcgggtaaaaccatt
ttgctggccaataaagaatcactggttacctgcggacgtctgtttatggacgccgtaaag
cagagcaaagcgcaattgttaccggtcgatagcgaacataacgccatttttcagagttta
ccgcaacctatccagcataatctgggatacgctgaccttgagcaaaatggcgtggtgtcc
attttacttaccgggtctggtggccctttccgtgagacgccattgcgcgatttggcaaca
atgacgccggatcaagcctgccgtcatccgaactggtcgatggggcgtaaaatttctgtc
gattcggctaccatgatgaacaaaggtctggaatacattgaagcgcgttggctgtttaac
gccagcgccagccagatggaagtgctgattcacccgcagtcagtgattcactcaatggtg
cgctatcaggacggcagtgttctggcgcagctgggggaaccggatatgcgtacgccaatt
gcccacaccatggcatggccgaatcgcgtgaactctggcgtgaagccgctcgatttttgc
aaactaagtgcgttgacatttgccgcaccggattatgatcgttatccatgcctgaaactg
gcgatggaggcgttcgaacaaggtcaggcagcgacgacagcattgaatgccgcaaacgaa
attaccgttgctgcttttcttgcgcaacaaatccgctttacggatatcgctgcgttgaat
ttatcggtactggaaaaaatggatatgcgcgaaccacaatgtgtggacgatgtgttatct
gttgatgcgaacgcgcgtgaagtcgccagaaaagaggtgatgcgtctcgcaagctga

DBGET integrated database retrieval system