KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0404Help
Entry
ECSE_0404         CDS       T00784                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ecy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ecy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
443468..444952
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNAVTEANQQKPL
LGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQ
VVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggat
tcggaaattactgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaa
ccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgctgcgctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaacgctcgtgccgacgttacgcttggcggtggcgcaaaaacctttgctgaaacggca
accgccggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtcagcgatgccgcctcgctaaatgcggtgacggaagcgaatcagcaaaaacccctg
cttggcctgtttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtac
cacggcaatatcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagt
gtaccaaccctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaa
ggatttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatcct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gctaaaaaggagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccag
gttgttgcgccggataccaaagcgccgggcctcactcaggcgctaaatactaaagatggc
gcagtgatggtgatgagttacgggaattccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccag
accgatctcttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system