KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0787Help
Entry
ECSE_0787         CDS       T00784                                 

Definition
(GenBank) succinyl-CoA synthase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00020  Citrate cycle (TCA cycle)
ecy00640  Propanoate metabolism
ecy00660  C5-Branched dibasic acid metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01130  Biosynthesis of antibiotics
ecy01200  Carbon metabolism
Module
ecy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECSE_0787
   00640 Propanoate metabolism
    ECSE_0787
   00660 C5-Branched dibasic acid metabolism
    ECSE_0787
Enzymes [BR:ecy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECSE_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAG76311
UniProt: B6I7Z9
Structure
PDB: 

Jmol
Position
845201..846367
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccagcaccg
gtgggttatgcctgtactactccgcgcgaagcagaagaagccgcttcaaaaatcggtgcc
ggcccgtgggtagtgaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgtg
aaagttgtaaacagcaaagaagacatccgtgcttttgcagaaaactggctcggcaagcgt
ctggtaacgtatcaaacagatgccaatggccaaccggttaaccagattctggttgaagca
gcgaccgatatcgctaaagagctgtatctcggtgccgttgtagaccgtagttcccgtcgt
gtggtctttatggcctccaccgaaggcggcgtggaaatcgaaaaagtggcggaagaaact
ccgcacctgatccacaaagttgcgcttgatccgctgactggcccgatgccgtatcaggga
cgcgagctggcgttcaaactgggtctggaaggtaaactggttcagcagttcaccaaaatc
ttcatgggcctggcgaccattttcctggagcgcgacctggcgttgatcgaaatcaacccg
ctggtcatcaccaaacagggcgatctgatttgcctcgacggcaaactgggcgctgacggc
aacgcactgttccgccagcctgatctgcgcgaaatgcgtgaccagtcgcaggaagatccg
cgtgaagcacaggctgcacagtgggaactgaactacgttgcgctggacggtaacatcggt
tgtatggttaacggcgcaggtctggcgatgggtacgatggacatcgttaaactgcacggc
ggcgaaccggctaacttccttgacgttggcggcggcgcaaccaaagaacgtgtaaccgaa
gcgttcaaaatcatcctctctgacgacaaagtgaaagccgttctggttaacatcttcggc
ggtatcgttcgttgcgacctgatcgctgacggtatcatcggcgcggtagcagaagtgggt
gttaacgtaccggtcgtggtacgtctggaaggtaacaacgccgaactcggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcaaaaggtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system