KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0809Help
Entry
ECSE_0809         CDS       T00784                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecy00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecy00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(869860..870900)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGEQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacgaaactcccgcactggcacccgatggtcagccgtaccgactgttaactttg
cgtaacaacgcagggatggtagtcacgctgatggactggggtgcgactttactttcagct
cgtattccgctttccgatggcagcgtccgcgaggcgctgctcggctgtgccagcccggaa
tgctatcaggatcaggctgcgtttctgggggcctctattggtcgttatgccaaccgcatc
gccaatagccgttatacctttgacggtgaaaccgtgacgctttcgccaagtcagggcgtt
aaccagctgcacggcggcccggaagggttcgacaaacgtcgctggcagattgtgaaccag
aacgatcgtcaggtgctgtttgccctgagttcagatgatggcgatcagggcttcccgggt
aatctcggcgcgacggtgcaatatcgtctgaccgacgataaccgtatctctattacttat
cgcgccacagttgataaaccttgcccggtgaatatgactaatcacgtctatttcaatctt
gacggcgagcagtctgacgtgcgcaatcacaagttgcagattctggcggacgaatatctg
ccggttgatgaaggcggcattccgcacgacggcctgaaatctgtcgccggaacgtctttt
gatttccgtagcgccaaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaa
gtgaaaggttacgatcacgcattcttgttacaggccaaaggcgatggcaagaaagtggcg
gcgcatgtctggtcagcagatgaaaaattgcagctgaaggtctacaccaccgctccggct
ctgcaattctactccggcaacttcctcggcggcacgccatcaagaggaactgaaccttac
gccgactggcaaggcctggcactggaaagcgagtttctgccggacagcccaaaccaccct
gaatggccgcaaccggactgcttcctgcgtcctggcgaagagtattccagcctgacggaa
tatcagtttattgctgagtag

DBGET integrated database retrieval system