KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_1567Help
Entry
ECSE_1567         CDS       T00784                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECSE_1567
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSE_1567
  Lipid metabolism
   00071 Fatty acid degradation
    ECSE_1567
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECSE_1567
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECSE_1567
   00626 Naphthalene degradation
    ECSE_1567
Enzymes [BR:ecy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECSE_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649895..1650935)
Genome map
AA seq 346 aa AA seqDB search
MQNIIRKGGTMKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGD
KTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAG
YSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGL
GGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAH
AAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDL
TEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatcatccgaaaaggaggaactatgaaggctgcagttgttacgaaggatcat
catgttgacgttacggataaaacactgcgctcactgaaacatggcgaagccctgctgaaa
atggagtgttgtggtgtatgtcataccgatcttcatgttaagaatggcgattttggtgac
aaaaccggcgtaattctgggccatgaaggcatcggtgtggtggcagaagttggcccaggt
gtcacctcattaaaaccaggcgatcgtgccagcgtggcgtggttctacgaaggatgcggt
cattgcgaatactgtaatagtggtaacgaaacgctctgccgttcagttaaaaatgccgga
tacagcgttgatggcgggatggcggaagagtgcatcgtggtcgccgattacgcggtaaaa
gtgccagatggtctggactcggcggcggccagcagcattacctgtgcgggggtcaccacc
tacaaagccgttaaactgtcaaaaattcgtccagggcagtggattgctatctacggtctt
ggcggtctgggtaacctcgctctgcaatacgcgaagaatgtctttaacgcgaaagtgatc
gccattgatgtcaatgatgagcagttaaaactggcaaccgaaatgggtgcagatttagcg
attaactcacgcaccgaagacgccgccaaaattgtgcaggagaaaaccggtggcgctcac
gctgcggtggtaacagcagttgctaaagctgcgtttaactcggcagttgatgctgtccgt
gcaggcggtcgtgttgtggctgtcggtctgccgccggagtctatgagcctggatatccca
cgccttgtgctggatggcattgaagtggtcggttcgctggtcggcacgcgccaggatcta
accgaagccttccagtttgccgccgaaggcaaagtggtgccgaaagtcgccctgcgtccg
ttagcggacatcaacaccatctttaccgagatggaagaaggcaaaatccgtggccgtatg
gtgattgatttccgccgttaa

DBGET integrated database retrieval system