KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_1892Help
Entry
ECSE_1892         CDS       T00784                                 

Definition
6-phosphofructokinase 2
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ecy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ecy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecy00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecy00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ecy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975666..1976598
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacacctggtttctctgttggcggatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgggttgtcgtttcccttggtccacaaggagcgctgggtgttgatagtgaaaactgcatt
caggtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgat
acgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system