KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_1939Help
Entry
ECSE_1939         CDS       T00784                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECSE_1939
Enzymes [BR:ecy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ECSE_1939
    3.5.1.-  
     ECSE_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2020986..2021627
Genome map
AA seq 213 aa AA seqDB search
MPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLNQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtaccggaaggtgacagtacggtggaggttgctaaccgccttattgactggtgc
cagtcgcgcggagaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccaggccaactcgacggtttgccacaa
accttctggccagatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aaccaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaacctctctcgatgactggttacgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtgaacgtgattaccgatggttgtcgtggc
gtgaatatccagccccaggacagtgcacacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagagacacaggggtaa

DBGET integrated database retrieval system