KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2118Help
Entry
ECSE_2118         CDS       T00784                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECSE_2118
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ECSE_2118
Enzymes [BR:ecy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ECSE_2118
Two-component system [BR:ecy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ECSE_2118
Bacterial motility proteins [BR:ecy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ECSE_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2183337..2184386)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELSRSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcgcctgatccgctggtc
gcgcgtgacttgattaagaaattcaatcccgatgtgctgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccttgaccggcaaagggtcagaagtcacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacagcagcaaaggcgagccttgcagcacataagcca
ttgtcggcaccgacaacgctgaaggcagggccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagcccggcactgttaattacccagcatatgccgcctggtttcacccgctcttttgcc
gacagacttaataagctttgtcagatcggggttaaagaagccgaagacggagaacgtgtc
ttgccggggcatgcctatattgcgccgggcgatcggcatatggagctgtcgcgtagtggc
gcaaattaccaaatcaaaattcacgatggcccggcggttaaccgtcatcggccttcggta
gatgtgttgttccattctgtcgccaaacaggcggggcgtaatgcggttggggtgatcctg
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagccagcaaatgttggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system