KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2316Help
Entry
ECSE_2316         CDS       T00784                                 

Definition
(GenBank) UDP-glucose pyrophosporylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00040  Pentose and glucuronate interconversions
ecy00052  Galactose metabolism
ecy00500  Starch and sucrose metabolism
ecy00520  Amino sugar and nucleotide sugar metabolism
ecy01100  Metabolic pathways
ecy01130  Biosynthesis of antibiotics
Module
ecy_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECSE_2316
   00052 Galactose metabolism
    ECSE_2316
   00500 Starch and sucrose metabolism
    ECSE_2316
   00520 Amino sugar and nucleotide sugar metabolism
    ECSE_2316
Enzymes [BR:ecy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECSE_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: BAG77840
UniProt: B6I8B3
Position
complement(2369133..2370026)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLNE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgagcagcgc
gtgaagcgtcaactactggcggaagtacagtccatttgcccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcacgtttcaacgaaacgggtcgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactctgttattcagaccaaa
gaaccgctggatcgcgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgctgat
atttggccggaacttgaacgcactcagccaggtgcatggggacgtattcaactgactgat
gccattgctgaattggcgaaaaaacagtccgttgatgccatgctgatgacaggtgacagc
tacgactgcggtaaaaaaatgggttatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaaacgaataa

DBGET integrated database retrieval system