KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2616Help
Entry
ECSE_2616         CDS       T00784                                 

Definition
histidine ABC transporter permease
Orthology
K10015  
histidine transport system permease protein
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ABC transporters
Module
Lysine/arginine/ornithine transport system
Histidine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ecy02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2698259..2698975)
Genome map
AA seq 238 aa AA seqDB search
MIEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIW
LFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEI
FAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTA
TVPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKPSSTH
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaatcttacatgaatactggaaaccgctgctgtggaccgacggttatcgcttt
actggtgtggcgatcactctgtggctgcttattttgtcggtagtgataggcggagtcctg
gcgctgtttctggcgattggtcgtgtctccagtaataaatacatccagtttccaatctgg
ttatttacctatatttttcgcggtacgccgctgtatgttcagttgctggtgttctattcc
ggcatgtacacgcttgagattgttaagggaaccgaattccttaacgctttcttccgcagt
ggcctgaactgtaccgtgctggcgctgacgcttaacacctgcgcttacactaccgagatt
tttgctggggcaatccgttcggttccgcatggggaaattgaagccgccagagcctatggc
ttctcgacttttaaaatgtatcgttgcattattttgccttctgcgctgcgtattgcgtta
ccggcatacagcaacgaagtgatcctgatgctgcactctactgcgctggcgtttacggcc
actgtgccggatctgctgaaaatagcccgcgatattaacgccgccacgtatcaacctttt
accgccttcggcattgccgcggtgctctatttaatcatctcttatgtcctgatcagcctc
tttcgcagagcggaaaaacgctggttgcagcatgtgaaaccttcttcaacgcactga

DBGET integrated database retrieval system