KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2616Help
Entry
ECSE_2616         CDS       T00784                                 

Definition
(GenBank) histidine ABC transporter permease component
  KO
K10015  histidine transport system permease protein
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy02010  ABC transporters
Module
ecy_M00225  Lysine/arginine/ornithine transport system
ecy_M00226  Histidine transport system
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECSE_2616
Transporters [BR:ecy02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter [MD:M00225]
    ECSE_2616
   Histidine transporter [MD:M00226] [OT]
    ECSE_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Stevor FtsX
Motif
Other DBs
NCBI-ProteinID: BAG78140
UniProt: B6I4V9
Position
complement(2698259..2698975)
Genome map
AA seq 238 aa AA seqDB search
MIEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIW
LFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEI
FAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTA
TVPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKPSSTH
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaatcttacatgaatactggaaaccgctgctgtggaccgacggttatcgcttt
actggtgtggcgatcactctgtggctgcttattttgtcggtagtgataggcggagtcctg
gcgctgtttctggcgattggtcgtgtctccagtaataaatacatccagtttccaatctgg
ttatttacctatatttttcgcggtacgccgctgtatgttcagttgctggtgttctattcc
ggcatgtacacgcttgagattgttaagggaaccgaattccttaacgctttcttccgcagt
ggcctgaactgtaccgtgctggcgctgacgcttaacacctgcgcttacactaccgagatt
tttgctggggcaatccgttcggttccgcatggggaaattgaagccgccagagcctatggc
ttctcgacttttaaaatgtatcgttgcattattttgccttctgcgctgcgtattgcgtta
ccggcatacagcaacgaagtgatcctgatgctgcactctactgcgctggcgtttacggcc
actgtgccggatctgctgaaaatagcccgcgatattaacgccgccacgtatcaacctttt
accgccttcggcattgccgcggtgctctatttaatcatctcttatgtcctgatcagcctc
tttcgcagagcggaaaaacgctggttgcagcatgtgaaaccttcttcaacgcactga

DBGET integrated database retrieval system