KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2964Help
Entry
ECSE_2964         CDS       T00784                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSE_2964
Enzymes [BR:ecy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECSE_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3075422..3076846
Genome map
AA seq 474 aa AA seqDB search
MSVFPEGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDELTPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGVTIDKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtggcaaagggctgaccacggtcgatatgatcccgcacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaagtgttccgtacctcaattgcctggagccgcctcttcccgcag
ggcgatgaactgacgcccaaccagcagggcattgctttttaccgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gccagaacctgctttgaagcatttgatggtctggtgaaatactggctcaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagttgcaagccggaagatgtctgggcggcgctggagaaagaccgg
gaaaacctgttttttatcgatgtgcaggcgcggggcgcgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgggcgatgatgaaatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaacagcagtgcggcgaacgtggtgaaatcgctgcgtaatccgtatctacag
gtgagcgactggggctggggaattgatccactcggtctgcgtatcaccatgaatatgatg
tacgatcgttatcagaagccgctgtttctggtggaaaacggcctgggcgcaaaagatgaa
tttgctgccaatggcgagattaacgacgactatcgcatcagctacttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagacggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggctttgtcttt
gttgaccgtgacgacgcaggcaacggtacgctgacgcgcacgcgtaagaaatcattctgg
tggtataaaaaagtgattgccagtaatggggaagatttagagtag

DBGET integrated database retrieval system