KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_3164Help
Entry
ECSE_3164         CDS       T00784                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3289208..3290647
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYCCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGAGDMSRSRKKSFNWYQEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggtggcgccgttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagtatttgtgacgtactg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccgggtaaatac
tatccgaaccatgaagccgttgatttttatggccactacaaagaagacatcaagctgttt
gccgaaatgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaa
ggtgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcggaagtggtgtttgaacgctataagcataaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtt
tataccgagcatgacaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccctactgctgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgat
ctcgatgtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggtttcgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctat
gccctttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtatcgttcaccaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtgctggcgatatgtcgcgttca
cgtaagaagagctttaactggtaccaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system