KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_4109Help
Entry
ECSE_4109         CDS       T00784                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECSE_4109
   00565 Ether lipid metabolism
    ECSE_4109
   00590 Arachidonic acid metabolism
    ECSE_4109
   00591 Linoleic acid metabolism
    ECSE_4109
   00592 alpha-Linolenic acid metabolism
    ECSE_4109
Enzymes [BR:ecy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ECSE_4109
    3.1.1.32  phospholipase A1
     ECSE_4109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4265680..4266549
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atctacacacaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccactgtggcgtggg
attttaggcccgaactcggtgttgggtgcatcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttcagacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggagttatgctaaacgatttgttttga

DBGET integrated database retrieval system