KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_4204Help
Entry
ECSE_4204         CDS       T00784                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00010  Glycolysis / Gluconeogenesis
ecy00030  Pentose phosphate pathway
ecy00051  Fructose and mannose metabolism
ecy00052  Galactose metabolism
ecy00680  Methane metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01130  Biosynthesis of antibiotics
ecy01200  Carbon metabolism
ecy01230  Biosynthesis of amino acids
ecy03018  RNA degradation
Module
ecy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSE_4204
   00030 Pentose phosphate pathway
    ECSE_4204
   00051 Fructose and mannose metabolism
    ECSE_4204
   00052 Galactose metabolism
    ECSE_4204
  Energy metabolism
   00680 Methane metabolism
    ECSE_4204
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECSE_4204
Enzymes [BR:ecy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECSE_4204
Protein phosphatases and associated proteins [BR:ecy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECSE_4204
Messenger RNA biogenesis [BR:ecy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECSE_4204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAG79728
UniProt: B6I4Q8
Structure
PDB: 

Jmol
Position
4369051..4370013
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggtatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtgtctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtggtatcgacgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggtctgcctggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgacgttggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gatctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggcggtcgttgcgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system