KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0004Help
Entry
ECS88_0004        CDS       T00830                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00260  Glycine, serine and threonine metabolism
ecz00750  Vitamin B6 metabolism
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01230  Biosynthesis of amino acids
Module
ecz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECS88_0004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECS88_0004 (thrC)
Enzymes [BR:ecz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECS88_0004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAR01371
UniProt: B7M9R7
Structure
PDB: 

Jmol
Position
3733..5019
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQILTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcacaatgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgtttttcccgcacgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtacgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatactgacccat
attgcgggcgataagccagtgaccattctgaccgcgacatccggtgatactggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacattgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggctaaactctgctaactccattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcacgacggtcagtggtcacccaaagcgactcaggcgacgttatccaatgcg
atggatgttagccagccaaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctggggtatgcagccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctatacctcggagccgcacgctgccgtagcttatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcgcataacctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system