KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0499Help
Entry
ECS88_0499        CDS       T00830                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ECS88_0499 (tesA)
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECS88_0499 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ECS88_0499 (tesA)
Lipid biosynthesis proteins [BR:ecz01004]
 Fatty acid synthase
  Component type
   ECS88_0499 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(526507..527133)
Genome map
AA seq 208 aa AA seqDB search
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgtta
accttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccggg
tatcgaatgtctgctagcgcggcctggcctgccttgttgaatgataagtggcagagtaaa
acgtcggtagtcaatgccagcatcagcggcgacacctcgcaacaagggctggcgcgcctt
ccggctctgctgaaacagcatcagccgcgctgggtgctggtagaactgggcggcaatgac
ggtttgcgtggttttcagccacaacaaaccgagcaaacgctgcgccagatattgcaggat
gtcaaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggt
cgccgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgtt
ccgctgctgcccttttttatggaagaggtctacctcaaaccacaatggatgcaggatgac
ggtattcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttg
cagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system