KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0699Help
Entry
ECS88_0699        CDS       T00830                                 

Gene name
asnB
Definition
(GenBank) asparagine synthetase B
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00250  Alanine, aspartate and glutamate metabolism
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECS88_0699 (asnB)
Enzymes [BR:ecz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ECS88_0699 (asnB)
Peptidases [BR:ecz01002]
 Cysteine Peptidases
  Family C44
   ECS88_0699 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: CAR02039
UniProt: B7MFT0
Structure
PDB: 

Jmol
Position
complement(712334..713998)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaactcatgtgctggcagtaaacggtgaaatctacaac
caccaggcattgcgcgctgaatatggcgatcgttaccagttccagaccgggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcatatctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacacggtcagctgtatgtggcctca
gaaatgaaagccctcgtgccagtttgccgcacgattaaagagtttccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactacgat
gcggtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgccgcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagttgcactcctttgctgtaggtctgccgggctcaccggat
ctgaaagcagcccaggaagtggcaaaccatcttggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacctatgac
gtgacgacaatccgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgaaggttctgacgaagtgtttggcggttatctatac
ttccacaaagcgccgaacgctaaagagttgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgtgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccacaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgaagcgtat
ctgcctgcaagcgtggcctggcggcaaaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcagcgcagcaggtttctgatcaacagctggaaact
gcccgcttccgcttcccgtacaacacgccgacctcaaaagaagcgtatctgtaccgggag
atctttgaagaattgttcccgcttccgagcgccgctgagtgcgtgccgggcggtccttcc
gtcgcttgttcttccgctaaagcgattgagtgggatgaagcgttcaagaaaatggacgat
ccgtctggtcgcgcggttggcgttcaccagtcggcatataaataa

DBGET integrated database retrieval system