KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0752Help
Entry
ECS88_0752        CDS       T00830                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyltranssuccinase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00020  Citrate cycle (TCA cycle)
ecz00310  Lysine degradation
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
Module
ecz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECS88_0752 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ECS88_0752 (sucB)
Enzymes [BR:ecz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECS88_0752 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: CAR02091
UniProt: B7MFY2
Structure
PDB: 

Jmol
Position
769202..770419
Genome map
AA seq 405 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAPAPAAQPALAARSEKRVP
MTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVK
AVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIK
ELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNG
QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagccgatgccaccgtc
gcaacctggcataaaaaacccggcgacgcagtcgtacgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcagacggcattctggatgcggtt
ctggaagatgaaggtacaacggtaacgtctcgtcagatccttggtcgcctgcgtgaaggc
aacagcgcgggtaaagaaaccagcgccaaatctgaagagaaagcgtccactccggcgcaa
cgccagcaggcgtctctggaagagcaaaacaacgatgcgttaagcccggcgatccgtcgc
ctgctggctgaacataacctcgacgccagcgctattaaaggcacgggtgtgggtggtcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaagccccggcgaaagagtctgctccg
gcagcgcctgctccggcggcgcaaccggccctggctgcacgtagcgaaaaacgtgtgccg
atgactcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgcc
atgctgaccacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtac
ggtgaagcgtttgaaaaacgccacggcatccgtctgggctttatgtccttctacgtgaaa
gcggtggttgaagccctgaaacgttacccggaagtgaatgcgtctatcgacggtgatgat
gtggtctaccacaactatttcgacgtcagtatggcggtttctacgccgcgcggtctggtg
acgccggttctgcgtgatgtcgataccctcggcatggcagacatcgagaagaaaatcaaa
gagctggctgttaaaggccgtgacggcaagctgacggttgaagatctgaccggtggtaac
ttcaccatcaccaacggtggtgtgttcggttccctgatgtcaacgcctatcatcaaccca
ccgcagagcgcaattctgggtatgcacgctatcaaagatcgtccgatggcagtgaatggt
caggttgagatcctgccgatgatgtacctggcgctgtcctacgatcaccgtttgatcgat
ggtcgcgaatccgtgggcttccttgtaacgatcaaagagttgctggaagatccgacgcgt
ctgctgctggacgtgtag

DBGET integrated database retrieval system