KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1396Help
Entry
ECS88_1396        CDS       T00830                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00260  Glycine, serine and threonine metabolism
ecz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01130  Biosynthesis of antibiotics
ecz01230  Biosynthesis of amino acids
Module
ecz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECS88_1396 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECS88_1396 (trpB)
Enzymes [BR:ecz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECS88_1396 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAR02719
UniProt: B7ML77
Structure
PDB: 

Jmol
Position
complement(1380178..1381371)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaactaaaattattgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgttttccggatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgaccctgaaagatgcctgtaatgaggcgctacgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggtaccgcagctggcccgcatccttacccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaacgaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggtggttcgaatgccatcggtatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtggagcctggcggccac
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcaaattgaagagtcttactccatt
tctgccgggctggatttcccgtccgtcggcccgcaacatgcgtatctcaacagcactgga
cgcgctgattacgtgtctattaccgacgatgaagccctggaagcctttaaaacgctttgc
ctgcatgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaatcccgaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system