KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1450Help
Entry
ECS88_1450        CDS       T00830                                 

Gene name
ycjM
Definition
glucosyltransferase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECS88_1450 (ycjM)
Enzymes [BR:ecz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ECS88_1450 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431542..1433221
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPKTDLSAVTRPRALPLLTPFQ
MRDHSMRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
NCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPENEILALVEV
LQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLSYSVYYKLSHLITLR
RSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITDLHGRDLISE
VDILGNEITLHPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcgact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagt
aatgatttaaagccactacccacatttaatcagttttaccctcaatggctgcaaagaatt
ttttcacatgttcatttattacctttttatccatggtcatctgatgatggattttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagccatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgatccg
aaaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaatgcgccatttatggaccacctttagcgacgatcaaattgacctc
aattaccgtagccctgaagtgttgctggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagagtatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
aactgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgtcgcgccaggcacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgaaggcgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcactttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttccttgcctctcacgatggcatc
gggcttaacccactgcgggggttgttgcccgaaaacgaaatattagcgctggtcgaggtg
ttacagcaggaaggagcattagtaaactggaaaaataatcccgacggtacgcgtagcccc
tatgaaatgaatgtcacctatatggatgcgttgagccgccgtgagtgtagcgacgaagaa
cggtgtgccaggtttattctcgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagcattctggggtcgcgtaatgattacgcaggtgtcgaaaaacttgga
tataatcgtgcgattaaccgtaaaaaatactctagtaaagagataacgacagaactgaac
aataaagcgacattaagttattcggtatattataagttgtcgcatttaattacacttcgt
cgcagtcataaagagtttcatccggataataatttcaccattgatgcgattaattcattt
gtaatgcgaattcaaagaagcaatgcggatggcgattgcctgacgggattgtttaatgtc
agtgaaaatattcagcatataaatattactgacctgcacggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacactgcatccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system