KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1609Help
Entry
ECS88_1609        CDS       T00830                                 

Gene name
celA
Definition
(RefSeq) 6-phospho-beta-glucosidase (EC:3.2.1.86)
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECS88_1609 (celA)
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECS88_1609 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1605411..1606880)
Genome map
AA seq 489 aa AA seqDB search
MVIYLVKELCMSGFKEDFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEG
VIDGLNYPNHEAIDFYHRYKTDIQLFAGMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFY
DDLFDECLKQGMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIHFASTVFTRYKAKVKY
WMTFNEINNQVNFSESLCPFTNSGILYSPEEDLNEREQIMYQAVHYELVASALAVQTGKL
INPEFNIGCMIAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKG
FNLDITPDDNAILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWG
WQIDPAGLRYSLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFSSHIREMKK
AVVEDGVDLIGYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRD
LIANNGENI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggtaatctatttagttaaggagttgtgtatgtcaggatttaaagaagattttttatgg
ggcggtgcggtagccgcacatcaattggaaggtggctggaatgaaggaggaaaaggcatc
agtatcgctgatgtaatgactgctggcgctcacggggtgccgcgtgaagtgacagaaggc
gttatcgacggacttaattatcccaatcatgaagcaattgatttttatcatcgctataaa
acagatattcagttatttgccgggatgggattcaaatgctttcgaacttccattgcctgg
acacgaatctttccgcaaggtgacgaacaggagccgaatgaagagggtttacaattttat
gatgatctcttcgatgaatgcctgaagcagggaatggaacctgtggtgacgctttcgcat
tttgagatgccttatcatctggtgacaaaatatggtggctggcgaaaccgtaaactgatc
gacttttttatccacttcgcatcaacggtcttcacgcgctataaagcaaaagtaaagtac
tggatgacgtttaacgaaatcaataatcaggtgaatttcagcgaaagcctgtgtccattt
actaattccggtatcttgtattcgccagaggaagatctcaatgagcgcgaacaaataatg
taccaggcggtacattatgagttagttgccagtgccctggcggtacagactggaaaactg
atcaatcctgaatttaatatcggctgtatgattgctatgtgccccatctatcctctgacg
tgtgcacccaacgatatgatgatggccacgaaagcgatgcatcgtcgttactggtttact
gatgttcatgctcgtggatattatccgcaacatatgctgaattactttgcaaggaaagga
ttcaacctcgatatcacaccagatgataacgcgattcttgccagaggttgtgtcgacttt
atcggctttagctactacatgtcttttacgacgcaattttcgccagataatccgcaactg
gattatgttgaaccacgagatttggtcagcaacccttatatcgatacatccgaatgggga
tggcaaattgatccggcagggctacgttattcactcaactggttctgggatcatttccag
ttgccgctgtttattgtcgaaaatggatttggtgcggttgaccagagacaagctgacggc
acggtgaacgatcactatcgcattgattacttttcctcccatattcgggaaatgaaaaaa
gccgtagttgaagatggtgttgacttaattggctacaccccgtggggttgcattgacctg
gtttctgccggaacaggagaaatgaaaaaacgctacggaatgatttatgtcgataaagac
aacgaagggaagggaacgctggaacggatacgtaaagcatcgttttactggtatcgggat
ctcatcgccaacaatggcgaaaatatatga

DBGET integrated database retrieval system