KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1820Help
Entry
ECS88_1820        CDS       T00830                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ecz00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1812567..1813208
Genome map
AA seq 213 aa AA seqDB search
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTALDDWLRAHVINELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtgccggaaggtgacagtacggtggatgtcgctaaccgcctgattgactggtgc
cagtcgcgcggtgaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccgggccaactcgacggtttgccacaa
accttctggcccgatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aagcaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaactgcgctcgatgactggttgcgcgct
catgtaatcaatgaattgatcgttatgggtctggctactgactattgcgttaagtttacc
gtgctggacgcgttacagttaggttataaggtgaacgtgattaccgatggttgtcgtggc
gtgaatatccagccacaggacagtgcgcacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system