KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_2488Help
Entry
ECS88_2488        CDS       T00830                                 

Gene name
yfcX
Definition
(GenBank) fused enoyl-CoA hydratase and epimerase and isomerase; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00071  Fatty acid degradation
ecz00280  Valine, leucine and isoleucine degradation
ecz00281  Geraniol degradation
ecz00310  Lysine degradation
ecz00362  Benzoate degradation
ecz00380  Tryptophan metabolism
ecz00410  beta-Alanine metabolism
ecz00640  Propanoate metabolism
ecz00650  Butanoate metabolism
ecz00903  Limonene and pinene degradation
ecz00930  Caprolactam degradation
ecz01040  Biosynthesis of unsaturated fatty acids
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
ecz01212  Fatty acid metabolism
Module
ecz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECS88_2488 (yfcX)
   00650 Butanoate metabolism
    ECS88_2488 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    ECS88_2488 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    ECS88_2488 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECS88_2488 (yfcX)
   00310 Lysine degradation
    ECS88_2488 (yfcX)
   00380 Tryptophan metabolism
    ECS88_2488 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECS88_2488 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECS88_2488 (yfcX)
   00281 Geraniol degradation
    ECS88_2488 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECS88_2488 (yfcX)
   00930 Caprolactam degradation
    ECS88_2488 (yfcX)
Enzymes [BR:ecz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECS88_2488 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECS88_2488 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECS88_2488 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAR03766
UniProt: B7MGV7
Position
complement(2485373..2487517)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQIRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEVLARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAV
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPRGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYCGFAHRDLIIEAVFENLELKQQMVAEVEQNCATHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHASTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERIEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIMPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGCKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCDRLVEMSERGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctcaaggcggaatttgcctcgcaggtacgc
gccattattaagcaaatccgtgaaaacaaagagttgcgtggcgtggtgtttgtctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagtactggcgcggcaggggcaacagttaatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagttggcg
ctggcgtgccacggtcgtgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggtacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcggta
aagttggggttggtggatgacgtcgttccgcactccatattgctggaagccgctgttgag
ctggcaaagcaggatcgcccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggtaagaaaacagaacacaaaacg
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagcggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggcgctgcgcaatatcttttttgccagtacggacgtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattctaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcggggcataaatcatgcgctgaagtacagttgggatcagcttgagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactattgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgctactcataccatcttt
gcttcgaacacgtcatctttaccgattggcgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgagtacatcggcgcaaaccatcgccaccacggtaaaactggcgaaaaaacag
ggcaaaacgccaattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacatcaatgaagctatccgcatgttgaccgaaggcgagcgtattgagcatatcgat
gccgcgctagtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattatgcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggtgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatataggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgatcgtttagttgagatgagcgag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system