KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_2652Help
Entry
ECS88_2652        CDS       T00830                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ecz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2636864..2637991
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacaacagcttattcgccgcccttccctgagtcct
gatgacgcaggatgccaggctttgttgattgaacgtttgcaggcgatcggttttaccgtt
gaacgcatggactttgccgatacgcagaatttttgggcatggcgtgggcagggtgaaacg
ttagcctttgccgggcataccgacgtggtgccgcctggcgacgccgaccgttggatcaat
ccgccgtttgaaccaaccattcgtgacggcatgttattcgggcgcggtgcggcagatatg
aaaggctcgctggcggcgatggtggtagctgcagaacgttttgtcgcacaacatcccaac
catacggggcgactggcatttctgatcacctctgatgaagaagccagtgcacacaatggt
acggtaaaagtcgtcgaagcgttaatggcacgtaatgagcgtctcgattactgcctggtt
ggcgaaccgtcgagtatcgaagtggtaggtgatgtggtgaaaaatggtcgtcgcggatcg
ttaacctgcaaccttaccattcatggcgttcaggggcatgttgcctacccacatctggct
gacaatccggtacatcgcgcagcacctttcattaatgaattagtggctattgagtgggat
cagggtaatgaattcttcccggcgaccagtatgcagattgccaatattcaggcgggaacg
ggcagtaacaacgttattccaggtgaactgtttgtgcagtttaacttccgctttagcacc
gaactgacggatgagatgatcaaagcgcaggtgcttgccctgcttgaaaaacatcaactg
cgctatacggtggattggtggctttccgggcagccatttttgaccgcgcgcggtaaactg
gtggatgcggtcgttaacgcggttgagcactataatgaaattaaaccgcagctactgacc
acaggcggaacgtccgacgggcgctttattgcccgcatgggggcgcaggtggtggaactc
gggccggtcaatgccacgattcataaaattaatgaatgtgtgaacgctgccgacctgcag
ctacttgcccgtatgtatcaacgtatcatggaacagctcgtcgcctga

DBGET integrated database retrieval system