KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3455Help
Entry
ECS88_3455        CDS       T00830                                 

Gene name
bacA
Definition
(GenBank) undecaprenyl pyrophosphate phosphatase
  KO
K06153  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECS88_3455 (bacA)
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     ECS88_3455 (bacA)
Peptidoglycan biosynthesis and degradation proteins [BR:ecz01011]
 Precursor biosynthesis
  Diphosphatase
   ECS88_3455 (bacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3418817..3419638)
Genome map
AA seq 273 aa AA seqDB search
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV
VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI
NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS
GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI
AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatgcactcgctgctgatagcggcaatattgggtgtggtcgaaggattgaca
gaatttctgccggtatccagcacgggccatatgattattgtcggtcacttgttggggttt
gagggcgacacggcgaaaacctttgaagtcgtgatccagttaggatcaattctggcggta
gtagtgatgttctggcggcgtctgtttggcctgattggcatccactttggtcgcccgttg
cagcacgaaggagaaagcaaaggtcgtttaacgctgatccacatcttgctggggatgatt
ccggcggtggtactggggctgttgttccacgacacgattaaatcattgtttaacccgata
aatgtcatgtatgcactggtcgttggcggtctgttgctgattgccgccgaatgcctgaag
ccgaaagagccgcgtgcgccgggtcttgatgatatgacctatcgtcaggcgtttatgatt
ggctgtttccagtgtctggcgctgtggccgggtttctcccgttccggggcgaccatttca
ggtgggatgctgatgggggtgagccgttacgctgcttccgagttctcgttcctgctggcg
gtgccgatgatgatgggcgcaacggcgctcgatctctacaaaagctggggcttcctgact
accggcgatatcccgatgtttgccgttgggtttatcaccgcttttgtggtggcgctgata
gcgattaaaaccttcctgcaattgattaagcgcatttcgtttatcccgttcgccatttat
cgctttattgtggcggctgcggtgtacgttgtgttcttttga

DBGET integrated database retrieval system